.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s12

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of TM1457 from Thermotoga maritima. J.Struct.Biol. 152 113-117 2005
    Site BSGC
    PDB Id 1s12 Target Id BSGCAIR30477
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8680, Molecular Weight 10539.81 Da.
    Residues 94 Isoelectric Point 8.93
    Sequence mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeelencevkvlaa mvrslkeleqkfpsqirvevidngs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.276
    Matthews' coefficent 2.44 Rfactor 0.214
    Waters 369 Solvent Content 49.23

    Ligand Information
    Ligands ACT (ACETATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch