| Title | Structural analyses of peptide release factor 1 from Thermotoga maritima reveal domain flexibility required for its interaction with the ribosome. J.Mol.Biol. 341 227-239 2004 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30383 | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS8531, | Molecular Weight | 39654.80 Da. | | Residues | 342 | Isoelectric Point | 5.35 | | Sequence | mkekkkeiekllarpdltpeqmknygmeyakieeienitnriketqefiellreegeneleiekyekel dqlyqellfllspeasdkaiveirpgtggeeaalfardlfrmytryaerkgwnlevaeihetdlggire vvffvkgknaygilkyesgvhrvqrvpvtesggrihtstatvavlpeieekdieirpedlkietfrasg hggqyvnktesavrithlptgivvscqnersqyqnkqtalrilrarlyqlqkeqkereisqkrksqigt gersekirtynfpqnrvtdhrinytsyrlqeildgdldeiiskliehdiennleevlgigasveek | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.65 | Rfree | 0.294 | | Matthews' coefficent | 2.32 | Rfactor | 0.216 | | Waters | 204 | Solvent Content | 47.09 |
| Ligand Information | | Ligands | | | Metals | | | |
