.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q8c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title A conserved hypothetical protein from Mycoplasma genitalium shows structural homology to nusb proteins. Proteins 55 1082-1086 2004
    Site BSGC
    PDB Id 1q8c Target Id BSGCAIR30482
    Molecular Characteristics
    Source Mycoplasma genitalium
    Alias Ids TPS8682, Molecular Weight 17479.52 Da.
    Residues 151 Isoelectric Point 8.91
    Sequence maitvkgltnkltrtqrriavvefifsllfflpkeaeviqadfleydtkerqlnewqklivkafsenif sfqkkieeqqlknqleiqtkynkisgkkidllttavvlcalseqkahntdkplliseallimdhysqga ekkqthalldkll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.27153
    Matthews' coefficent 2.42 Rfactor 0.25352
    Waters 61 Solvent Content 49.25

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 3;IOD (IODIDE) x 7;CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch