| Title | Solution structure of a putative ribosome binding protein from Mycoplasma pneumoniae and comparison to a distant homolog. J.STRUCT.FUNCT.GENOM. 4 235-243 2003 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30410 | | Molecular Characteristics | | Source | Mycoplasma pneumoniae | | Alias Ids | TPS8665, | Molecular Weight | 13388.82 Da. | | Residues | 116 | Isoelectric Point | 9.41 | | Sequence | masykkerlendiirlinrtviheiynetvktghvthvklsddllhvtvyldcynreqidrvvgafnqa kgvfsrvlahnlylakavqihfvkdkaidnamriesiinslkkskpn | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
