| Title | Structure of the hypothetical protein AQ_1354 from Aquifex aeolicus. Acta Crystallogr.,Sect.D 59 1219-1223 2003 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30418 | | Molecular Characteristics | | Source | Aquifex aeolicus | | Alias Ids | TPS8669, | Molecular Weight | 17337.10 Da. | | Residues | 150 | Isoelectric Point | 9.13 | | Sequence | msstkrqknrvlvklkkrkvrkdkiekwaelalsalglnnvelsvyitddqeirelnktyrkkdkptdv lsfpmgeefggykilgdvvisqdtaerqarelghsleeevkrlivhgivhllgydhekggeeekkfrel enyvlsklskal | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.89 | Rfree | 0.23423 | | Matthews' coefficent | 2.76 | Rfactor | 0.20524 | | Waters | 50 | Solvent Content | 55.07 |
| Ligand Information | | Ligands | | | Metals | | | |