| Title | Crystal structure of a protein associated with cell division from Mycoplasma pneumoniae (GI: 13508053): a novel fold with a conserved sequence motif. Proteins 55 785-791 2004 | | Site | BSGC | | PDB Id | 1n0g | Target Id | BSGCAIR30390 | | Related PDB Ids 1n0e,1n0f | | Molecular Characteristics | | Source | Mycoplasma pneumoniae | | Alias Ids | | Molecular Weight | 16333.85 Da. | | Residues | 141 | Isoelectric Point | 5.88 | | Sequence | mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfpstqkdtrtlkr lifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkklyedylansesletvaermkd vk | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.80 | Rfree | 0.283 | | Matthews' coefficent | 2.54 | Rfactor | 0.229 | | Waters | 77 | Solvent Content | 51.56 |
| Ligand Information | | Ligands | | | Metals | | | |
