| Title | Crystal structure of a protein associated with cell division from Mycoplasma pneumoniae (GI: 13508053): a novel fold with a conserved sequence motif. Proteins 55 785-791 2004 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30390 | | Related PDB Ids 1n0f 1n0g | | Molecular Characteristics | | Source | Mycoplasma pneumoniae | | Alias Ids | TPS8554, | Molecular Weight | 16333.85 Da. | | Residues | 141 | Isoelectric Point | 5.88 | | Sequence | mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfpstqkdtrtlk rlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkklyedylansesletvaermk dvk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 8 | | Resolution (Å) | 2.70 | Rfree | 0.279 | | Matthews' coefficent | 2.56 | Rfactor | 0.231 | | Waters | 534 | Solvent Content | 51.94 |
| Ligand Information | | Ligands | | | Metals | | | |
