| Title | Structure-based assignment of the biochemical function of a hypothetical protein: a test case of structural genomics. Proc.Natl.Acad.Sci.USA 95 15189-15193 1998 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30507 | | Molecular Characteristics | | Source | Methanococcus jannaschii | | Alias Ids | TPS8685, | Molecular Weight | 18337.63 Da. | | Residues | 162 | Isoelectric Point | 6.93 | | Sequence | msvmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvaglnksveef enelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeil lgsvtenvikksnkpvlvvkrkns | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.70 | Rfree | 0.254 | | Matthews' coefficent | 2.34 | Rfactor | 0.21 | | Waters | 284 | Solvent Content | 47.48 |
| Ligand Information | | Ligands | ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2 | | Metals | MN (MANGANESE) x 2 | | |
