| Title | Crystal structure of a hypothetical protein, TM841 of Thermotoga maritima, reveals its function as fatty acid binding protein. Proteins 50 526-530 2003 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30341 | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS8326, | Molecular Weight | 32572.90 Da. | | Residues | 288 | Isoelectric Point | 5.86 | | Sequence | mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsvpktsqpsve dfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtllasgaiplparvaremlen gatieevlkkldermknkdfkaifyvsnfdylvkggrvskfqgfvgnllkirvclhiengelipyrkvr gdkkaiealieklredtpegsklrvigvhadneagvvellntlrksyevvdeiispmgkvitthvgpgt vgfgievlerkr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.228 | | Matthews' coefficent | 2.42 | Rfactor | 0.202 | | Waters | 224 | Solvent Content | 49.24 |
| Ligand Information | | Ligands | PLM (PALMITIC) x 1 | | Metals | | | |
