| Title | Crystal structure of MJ1247 protein from M. jannaschii at 2.0 A resolution infers a molecular function of 3-hexulose-6-phosphate isomerase. Structure 10 195-204 2002 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30509 | | Molecular Characteristics | | Source | Methanococcus jannaschii | | Alias Ids | TPS8687, | Molecular Weight | 20441.95 Da. | | Residues | 180 | Isoelectric Point | 8.28 | | Sequence | mskleeldivsnnililkkfytndewknkldslidriikakkififgvgrsgyigrcfamrlmhlgfks yfvgetttpsyekddllilisgsgrtesvltvakkakninnniiaivcecgnvvefadltiplevkksk ylpmgttfeetalifldlviaeimkrlnldeseiikrhcnll | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.00 | Rfree | 0.2265000 | | Matthews' coefficent | 2.33 | Rfactor | 0.1891000 | | Waters | 72 | Solvent Content | 47.20 |
| Ligand Information | | Ligands | CIT (CITRIC) x 1 | | Metals | | | |
