.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j97

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title BeF(3)(-) acts as a phosphate analog in proteins phosphorylated on aspartate: structure of a BeF(3)(-) complex with phosphoserine phosphatase. Proc.Natl.Acad.Sci.USA 98 8525-8530 2001
    Site BSGC
    PDB Id 1j97 Target Id BSGCAIR30380
    Related PDB Ids 1f5s 1l7m 1l7n 1l7o 1l7p 
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8384, Molecular Weight 23592.31 Da.
    Residues 211 Isoelectric Point 7.60
    Sequence mekkkklilfdfdstlvnnetideiareagveeevkkitkeamegklnfeqslrkrvsllkdlpiekve kaikritptegaeetikelknrgyvvavvsggfdiavnkikeklgldyafanrlivkdgkltgdvegev lkenakgeilekiakieginledtvavgdgandismfkkaglkiafcakpilkekadiciekrdlreil kyik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.209
    Matthews' coefficent 2.32 Rfactor 0.189
    Waters 402 Solvent Content 47.04

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch