.
The Open Protein Structure Annotation Network
PDB Keyword
.

1fbn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of a fibrillarin homologue from Methanococcus jannaschii, a hyperthermophile, at 1.6 A resolution. EMBO J. 19 317-323 2000
    Site BSGC
    PDB Id 1fbn Target Id BSGCAIR30365
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8329, Molecular Weight 25964.84 Da.
    Residues 230 Isoelectric Point 5.67
    Sequence medikikeifeniyevdlgdglkriatksivkgkkvydekiikigdeeyriwnpnksklaaaiikglkv mpikrdskilylgasagttpshvadiadkgivyaieyaprimrelldacaereniipilgdankpqeya nivekvdviyedvaqpnqaeiliknakwflkkggygmiaikarsidvtkdpkeifkeqkeileaggfki vdevdiepfekdhvmfvgiwegk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.248
    Matthews' coefficent 2.78 Rfactor 0.229
    Waters 186 Solvent Content 0.47

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch