| Title | Crystal structure of archaeal RNase HII: a homologue of human major RNase H. Structure 8 897-904 2000 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30321 | | Molecular Characteristics | | Source | Methanococcus jannaschii | | Alias Ids | TPS8323, | Molecular Weight | 26504.36 Da. | | Residues | 230 | Isoelectric Point | 8.49 | | Sequence | miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlgyvekrilea eeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkkfedsfkdkiediikernl nikiiaehkadakypvvsaasiiakaerdeiidyykkiygdigsgypsdpktikfledyfkkhkklpdi arthwktckrildkskqtkliie | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.262 | | Matthews' coefficent | 2.36 | Rfactor | 0.21 | | Waters | 313 | Solvent Content | 48.00 |
| Ligand Information | | Ligands | MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2 | | Metals | | | |
