| Title | Structure-based experimental confirmation of biochemical function to a methyltransferase, MJ0882, from hyperthermophile Methanococcus jannaschii. J.STRUCT.FUNCT.GENOM. 2 121-127 2002 | | Site | BSGC | | PDB Id | | Target Id | BSGCAIR30382 | | Molecular Characteristics | | Source | Methanococcus jannaschii | | Alias Ids | TPS8510, | Molecular Weight | 22242.70 Da. | | Residues | 197 | Isoelectric Point | 9.31 | | Sequence | mhyfsekpttksdvkivedilrgkklkfktdsgvfsygkvdkgtkilvenvvvdkdddildlgcgygvi gialadevksttmadinrraiklakeniklnnldnydirvvhsdlyenvkdrkynkiitnppiragkev lhriieegkellkdngeiwvviqtkqgakslakymkdvfgnvetvtikggyrvlkskkl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.80 | Rfree | 0.235 | | Matthews' coefficent | 1.99 | Rfactor | 0.188 | | Waters | 163 | Solvent Content | 38.05 |
| Ligand Information | | Ligands | | | Metals | | | |
