| Title | Crystal Structure of a Yahk, a Zinc-Type Alcohol Dehydrogenase-Like Protein. To be Published | | Site | BIGS | | PDB Id | | Target Id | ASG-yahK | | Molecular Characteristics | | Source | Escherichia coli k12 | | Alias Ids | TPS11898, | Molecular Weight | 37976.39 Da. | | Residues | 349 | Isoelectric Point | 5.80 | | Sequence | mkikavgaysakqplepmditrrepgpndvkieiaycgvchsdlhqvrsewagtvypcvpgheivgrvv avgdqvekyapgdlvgvgcivdsckhceecedglenycdhmtgtynsptpdepghtlggysqqivvher yvlrirhpqeqlaavapllcagittysplrhwqagpgkkvgvvgigglghmgiklahamgahvvaftts eakreaakalgadevvnsrnademaahlksfdfilntvaaphnlddfttllkrdgtmtlvgapatphks pevfnlimkrraiagsmiggipetqemldfcaehgivadiemiradqineayermlrgdvkyrfvidnrtltd | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.76 | Rfree | 0.208 | | Matthews' coefficent | 2.25 | Rfactor | 0.184 | | Waters | 375 | Solvent Content | 45 |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 2 | | |