| Title | MAD Crystal Structure of the Unknown Function E. Coli Yeaz Protein. To be Published | | Site | BIGS | | PDB Id | | Target Id | IGS-yeaZ | | Molecular Characteristics | | Source | Escherichia coli k12 | | Alias Ids | TPS11906, | Molecular Weight | 25179.50 Da. | | Residues | 231 | Isoelectric Point | 5.02 | | Sequence | mrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinalaygrgpgsft gvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarmgevywaeyqrdengiwhge eteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegkt vavehaepvylrnnvawkklpgke | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.28 | Rfree | 0.257 | | Matthews' coefficent | 2.36 | Rfactor | 0.216 | | Waters | 303 | Solvent Content | 47.9 |
| Ligand Information | | Ligands | | | Metals | GD3 (GADOLINIUM) x 8 | | |
