| Title | Crystal Structure of Ydhf, an Aldo-Keto Reductase from Escherichia Coli. To be Published | | Site | BIGS | | PDB Id | | Target Id | ASG-ydhF | | Molecular Characteristics | | Source | Escherichia coli k12 | | Alias Ids | TPS11900, | Molecular Weight | 33624.79 Da. | | Residues | 298 | Isoelectric Point | 5.77 | | Sequence | mvqritiapqgpefsrfvmgywrlmdwnmsarqlvsfieehldlgvttvdhadiyggyqceaafgealk laphlrermeivskcgiattareenvighyitdrdhiiksaeqslinlatdhldlllihrpdplmdade vadafkhlhqsgkvrhfgvsnftpaqfallqsrlpftlatnqveispvhqpllldgtldqlqqlrvrpm awsclgggrlfnddyfqplrdelavvaeelnagsieqvvnawvlrlpsqplpiigsgkiervraaveae tlkmtrqqwfrirkaalgydvp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.8 | Rfree | 0.238 | | Matthews' coefficent | 2.93 | Rfactor | 0.207 | | Waters | 199 | Solvent Content | 58 |
| Ligand Information | | Ligands | NAP (NADP) x 3 | | Metals | | | |
