| Title | Crystal structure of escherichia coli gene product Yecd at 1.3 A resolution. To be published | | Site | BIGS | | PDB Id | | Target Id | ASG-yecD | | Molecular Characteristics | | Source | Escherichia coli k12 | | Alias Ids | TPS11901, | Molecular Weight | 20451.08 Da. | | Residues | 188 | Isoelectric Point | 5.37 | | Sequence | mlelnakttalvvidlqegilpfaggphtadevvnragklaakfrasgqpvflvrvgwsadyaealkqp vdapspakvlpenwwqhpaalgatdsdieiikrqwgafygtdlelqlrrrgidtivlcgistnigvest arnawelgfnlviaedacsaasaeqhnnsinhiypriarvrsveeilnal | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.30 | Rfree | 0.16494 | | Matthews' coefficent | 2.03 | Rfactor | 0.14499 | | Waters | 924 | Solvent Content | 39.06 |
| Ligand Information | | Ligands | MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 12 | | Metals | | | |