| Title | Structure and Evolution of a Paradoxical Protein Family of Vertebrate Lysozyme Inhibitors Only Found in Gram-Negative Bacteria. To be Published | | Site | BIGS | | PDB Id | | Target Id | ORPH-ykfE | | Molecular Characteristics | | Source | Escherichia coli k12 | | Alias Ids | TPS11905, | Molecular Weight | 16871.41 Da. | | Residues | 157 | Isoelectric Point | 6.27 | | Sequence | mgrissggmmfkaittvaalviatsamaqddltisslakgettkaafnqmvqghklpawvmkggtytpa qtvtlgdetyqvmsackphdcgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktv lfaaltgslenhpdgfnfk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.6 | Rfree | 0.212 | | Matthews' coefficent | 1.98 | Rfactor | 0.181 | | Waters | 635 | Solvent Content | 38 |
| Ligand Information | | Ligands | | | Metals | | | |
