| Title | Three-dimensional structure of the EphB2 receptor in complex with an antagonistic peptide reveals a novel mode of inhibition. J.Biol.Chem. 282 36505-36513 2007 | | Site | ATCG3D | | PDB Id | | Target Id | ATCG3D_15 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS11892,CAI22647 | Molecular Weight | 20223.71 Da. | | Residues | 176 | Isoelectric Point | 5.42 | | Sequence | eetlmdsttataelgwmvhppsgweevsgydenmntirtyqvcnvfessqnnwlrtkfirrrgahrihv emkfsvrdcssipsvpgscketfnlyyyeadfdsatktfpnwmenpwvkvdtiaadesfsqvdlggrvm kintevrsfgpvsrsgfylafqdyggcmsliavrvfyr | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.30 | Rfree | 0.2695 | | Matthews' coefficent | 2.18 | Rfactor | 0.19424 | | Waters | 174 | Solvent Content | 43.46 |
| Ligand Information | | Ligands | SER-ASN-GLU-TRP-ILE-GLN-PRO-ARG-LEU (SULFATE) x 1;SO4 x 12 | | Metals | | | |
