| Title | Structural and Biophysical Characterization of the EphB4-EphrinB2 Protein-Protein Interaction and Receptor Specificity. J.Biol.Chem. 281 28185-28192 2006 | | Site | ATCG3D | | PDB Id | | Target Id | ATCG3D_14 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS11891, | Molecular Weight | 21321.14 Da. | | Residues | 188 | Isoelectric Point | 6.91 | | Sequence | aghhhhhheetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapgqahwlrtgw vprrgavhvyatlrftmleclslpragrscketftvfyyesdadtataltpawmenpyikvdtvaaehl trkrpgaeatgkvnvktlrlgplskagfylafqdqgacmallslhlfykk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.05 | Rfree | 0.29521 | | Matthews' coefficent | 2.25 | Rfactor | 0.22567 | | Waters | 79 | Solvent Content | 45.42 |
| Ligand Information | | Ligands | | | Metals | | | |
