| Title | Structure and thermodynamic characterization of the EphB4/Ephrin-B2 antagonist peptide complex reveals the determinants for receptor specificity. Structure 14 321-330 2006 | | Site | ATCG3D | | PDB Id | | Target Id | ATCG3D_13 | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS11889,AAL14194 | Molecular Weight | 21055.88 Da. | | Residues | 185 | Isoelectric Point | 6.86 | | Sequence | hhhhheetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapgqahwlrtgwvpr rgavhvyatlrftmleclslpragrscketftvfyyesdadtataltpawmenpyikvdtvaaehltrk rpgaeatgkvnvktlrlgplskagfylafqdqgacmallslhlfykk | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.65 | Rfree | 0.19135 | | Matthews' coefficent | 3.09 | Rfactor | 0.17436 | | Waters | 223 | Solvent Content | 60.20 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 2 | | Metals | | | |
